Recombinant Papio hamadryas Sperm acrosome membrane-associated protein 3 (SPACA3), partial
Product Sizes
20 ug
£434.00
CSB-EP022454ERJ-20UG
100 ug
£815.00
CSB-EP022454ERJ-100UG
1 mg
£2756.00
CSB-EP022454ERJ-1MG
About this Product
- SKU:
- CSB-EP022454ERJ
- Additional Names:
- (Sperm protein reactive with antisperm antibodies)(Sperm protein reactive with ASA)(Fragment)|Recombinant Papio hamadryas SPACA3 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 16.5 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- KVYSRCELARVLQDFGLDGYRGYSLADWVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12932910/
