Recombinant Human S-phase kinase-associated protein 1 (SKP1)
Product Sizes
20 ug
£251.00
CSB-EP021360HU-20UG
100 ug
£468.00
CSB-EP021360HU-100UG
1 mg
£2025.00
CSB-EP021360HU-1MG
About this Product
- SKU:
- CSB-EP021360HU
- Additional Names:
- Cyclin-A/CDK2-associated protein p19 ;p19AOrgan of Corti protein 2 ;OCP-2Organ of Corti protein II ;OCP-IIRNA polymerase II elongation factor-like protein;SIIITranscription elongation factor B polypeptide 1-likep19skp1|Recombinant Human SKP1 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 45.5 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/1031595/
