Recombinant Mouse SAM domain and HD domain-containing protein 1 (SAMHD1), partial
Product Sizes
20 ug
£342.00
CSB-EP020691MO-20UG
100 ug
£646.00
CSB-EP020691MO-100UG
1 mg
£2756.00
CSB-EP020691MO-1MG
About this Product
- SKU:
- CSB-EP020691MO
- Additional Names:
- Interferon-gamma-inducible protein Mg11SAM domain and HD domain-containing protein 1|Recombinant Mouse SAMHD1 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 30.6 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- DIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/1029960/
