Recombinant Human Remodeling and spacing factor 1 (RSF1), partial
Product Sizes
20 ug
£226.00
CSB-EP020540HU-20UG
100 ug
£380.00
CSB-EP020540HU-100UG
1 mg
£1468.00
CSB-EP020540HU-1MG
About this Product
- SKU:
- CSB-EP020540HU
- Additional Names:
- HBV pX-associated protein 8;Hepatitis B virus X-associated protein;p325 subunit of RSF chromatin-remodeling complex|Recombinant Human RSF1 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 17.4 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >95%
- Sequence:
- IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12945630/
