Recombinant Human Regulator of G-protein signaling 5 (RGS5)
Product Sizes
20 ug
£251.00
CSB-EP019657HU-20UG
100 ug
£468.00
CSB-EP019657HU-100UG
1 mg
£2025.00
CSB-EP019657HU-1MG
About this Product
- SKU:
- CSB-EP019657HU
- Additional Names:
- MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; Regulator of G Protein Signalling 5; Regulator of G-protein signaling 5; RGS 5; RGS5; RGS5_HUMAN|Recombinant Human RGS5 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 47.9 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/11186012/
