Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1)
Product Sizes
20 ug
£251.00
CSB-EP017514HUA0-20UG
100 ug
£468.00
CSB-EP017514HUA0-100UG
1 mg
£2025.00
CSB-EP017514HUA0-1MG
About this Product
- SKU:
- CSB-EP017514HUA0
- Additional Names:
- 4-alpha-hydroxy-tetrahydropterin dehydratase Dimerization cofactor of hepatocyte nuclear factor 1-alpha Short name: DCoH Short name: Dimerization cofactor of HNF1 Phenylalanine hydroxylase-stimulating protein Pterin carbinolamine dehydratase DCOH, PCBD|Recombinant Human PCBD1 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 15.9 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12783029/
