Recombinant Human Ragulator complex protein LAMTOR3 (LAMTOR3)
Product Sizes
20 ug
£204.00
CSB-EP013477HUC7-20UG
100 ug
£339.00
CSB-EP013477HUC7-100UG
1 mg
£1296.00
CSB-EP013477HUC7-1MG
About this Product
- SKU:
- CSB-EP013477HUC7
- Additional Names:
- Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3;MEK-binding partner 1;Mp1;Mitogen-activated protein kinase kinase 1-interacting protein 1;Mitogen-activated protein kinase scaffold protein 1|Recombinant Human LAMTOR3 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 19.7 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >95%
- Sequence:
- MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12942986/
