Recombinant Human Integrin beta-7 (ITGB7), partial
Product Sizes
20 ug
£342.00
CSB-EP011891HU2-20UG
100 ug
£646.00
CSB-EP011891HU2-100UG
1 mg
£2756.00
CSB-EP011891HU2-1MG
About this Product
- SKU:
- CSB-EP011891HU2
- Additional Names:
- Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to gut-associated lymphoid tissue (GALT).|Recombinant Human ITGB7 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 42.0 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12932588/


