Recombinant Human DNA-binding protein inhibitor ID-3 (ID3)
Product Sizes
20 ug
£261.00
CSB-EP010969HU-20UG
100 ug
£448.00
CSB-EP010969HU-100UG
1 mg
£1746.00
CSB-EP010969HU-1MG
About this Product
- SKU:
- CSB-EP010969HU
- Additional Names:
- Class B basic helix-loop-helix protein 25;Helix-loop-helix protein HEIR-1;ID-like protein inhibitor HLH 1R21;Inhibitor of DNA binding 3;Inhibitor of differentiation 3|Recombinant Human ID3 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 31.2 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12943969/
