Recombinant Human DNA-binding protein inhibitor ID-2 (ID2)
Product Sizes
20 ug
£251.00
CSB-EP010967HU-20UG
100 ug
£468.00
CSB-EP010967HU-100UG
1 mg
£2025.00
CSB-EP010967HU-1MG
About this Product
- SKU:
- CSB-EP010967HU
- Additional Names:
- Class B basic helix-loop-helix protein 26 ;bHLHb26Inhibitor of DNA binding 2Inhibitor of differentiation 2|Recombinant Human ID2 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 30.9 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/1030065/
