Recombinant Human DNA-binding protein inhibitor ID-1 (ID1)
Product Sizes
20 ug
£251.00
CSB-EP010966HU-20UG
100 ug
£468.00
CSB-EP010966HU-100UG
1 mg
£2025.00
CSB-EP010966HU-1MG
About this Product
- SKU:
- CSB-EP010966HU
- Additional Names:
- Class B basic helix-loop-helix protein 24 ;bHLHb24Inhibitor of DNA binding 1Inhibitor of differentiation 1|Recombinant Human ID1 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 32.1 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/1031203/
