Recombinant Human Serine/threonine-protein kinase mTOR (MTOR), partial
Product Sizes
20 ug
£286.00
CSB-EP008968HU-20UG
100 ug
£536.00
CSB-EP008968HU-100UG
1 mg
£2305.00
CSB-EP008968HU-1MG
About this Product
- SKU:
- CSB-EP008968HU
- Additional Names:
- FK506-binding protein 12-rapamycin complex-associated protein 1 (FKBP12-rapamycin complex-associated protein) (Mammalian target of rapamycin) (mTOR) (Mechanistic target of rapamycin) (Rapamycin and FKBP12 target 1) (Rapamycin target protein 1)|Recombinant Human MTOR protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 23.2 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- VSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12928436/
