Recombinant Human FERM, ARHGEF and pleckstrin domain-containing protein 2 (FARP2), partial
Product Sizes
20 ug
£342.00
CSB-EP008428HU-20UG
100 ug
£646.00
CSB-EP008428HU-100UG
1 mg
£2756.00
CSB-EP008428HU-1MG
About this Product
- SKU:
- CSB-EP008428HU
- Additional Names:
- FERM domain-including RhoGEF;FIR;FERM, RhoGEF and pleckstrin domain-containing protein 2;Pleckstrin homology domain-containing family C member 3;PH domain-containing family C member 3|Recombinant Human FARP2 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 40.3 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- LHLRVKLLDNTMEIFDIEPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLDREHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDREGTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12936531/
