Recombinant Mouse CD81 antigen (Cd81), partial
Product Sizes
20 ug
£286.00
CSB-EP004960MOC0-20UG
100 ug
£536.00
CSB-EP004960MOC0-100UG
1 mg
£2305.00
CSB-EP004960MOC0-1MG
About this Product
- SKU:
- CSB-EP004960MOC0
- Additional Names:
- 26 kDa cell surface protein TAPA-1;Target of the antiproliferative antibody 1;CD antigen CD81|Recombinant Mouse Cd81 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 40.9 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12937450/
