Recombinant Human Cytochrome c oxidase assembly protein 1 homolog (COA1), partial
Product Sizes
20 ug
£251.00
CSB-EP004170HU-20UG
100 ug
£468.00
CSB-EP004170HU-100UG
1 mg
£2025.00
CSB-EP004170HU-1MG
About this Product
- SKU:
- CSB-EP004170HU
- Additional Names:
- Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15KDA|Recombinant Human COA1 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 39.4 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/1030017/


