Recombinant Human Membrane progestin receptor alpha (PAQR7)
Product Sizes
20 ug
£1811.00
CSB-CF768224HU-20UG
100 ug
£3018.00
CSB-CF768224HU-100UG
About this Product
- SKU:
- CSB-CF768224HU
- Additional Names:
- mPR alpha ;Membrane progesterone P4 receptor alpha;Membrane progesterone receptor alpha ;Progesterone and adipoQ receptor family member 7;Progestin and adipoQ receptor family member 7;Progestin and adipoQ receptor family member VII|Recombinant Human PAQR7 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 41.2 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/11149866/
