Recombinant Mouse Stimulator of interferon genes protein (Sting1)
Product Sizes
20 ug
£1811.00
CSB-CF023754MO-20UG
100 ug
£3018.00
CSB-CF023754MO-100UG
About this Product
- SKU:
- CSB-CF023754MO
- Additional Names:
- mSTING (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (Transmembrane protein 173) (Eris) (Mita) (Mpys) (Sting)|Recombinant Mouse Sting1 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 48.9 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/11140626/
