Recombinant Human Adiponectin receptor protein 1 (ADIPOR1), partial
Product Sizes
20 ug
£981.00
CSB-CF001367HU2-20UG
100 ug
£1587.00
CSB-CF001367HU2-100UG
About this Product
- SKU:
- CSB-CF001367HU2
- Additional Names:
- Progestin and adipoQ receptor family member 1 (Progestin and adipoQ receptor family member I) (PAQR1) (TESBP1A)|Recombinant Human ADIPOR1 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 34.8 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12927523/
