Recombinant Mouse Thrombopoietin protein (Thpo), partial (Active)
Product Sizes
10 ug
£395.00
CSB-AP003451MO-10UG
100 ug
£1868.00
CSB-AP003451MO-100UG
500 ug
£4192.00
CSB-AP003451MO-500UG
About this Product
- SKU:
- CSB-AP003451MO
- Additional Names:
- C-mpl ligand, Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, MGDF, Myeloproliferative leukemia virus oncogene ligand|Recombinant Mouse Thpo protein, partial (Active)
- Buffer:
- Lyophilized from a 0.2 um filtered PBS, pH 7.4, with 5% Trehalose
- Molecular Weight:
- 18.7 kDa
- Physical State:
- Lyophilized
- Purity:
- >95%
- Sequence:
- SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/11098394/
