Recombinant Human Interleukin-17B protein (IL17B) (Active)
Product Sizes
5 ug
£218.00
CSB-AP001651HU-5UG
100 ug
£1304.00
CSB-AP001651HU-100UG
500 ug
£2926.00
CSB-AP001651HU-500UG
About this Product
- SKU:
- CSB-AP001651HU
- Additional Names:
- IL-17B, Interleukin-20, IL-20, Neuronal interleukin-17-related factor,|Recombinant Human IL17B protein (Active)
- Buffer:
- Lyophilized from a 0.2 um filtered PBS, pH 7.4, with 0.1 % Tween-20 and 3 % Trehalose
- Molecular Weight:
- 18.3 kDa
- Physical State:
- Lyophilized
- Purity:
- >95%
- Sequence:
- M+QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/11098278/
