Anti-Agouti related protein (AGRP) Antibody
Product Sizes
50 ul
GP-029-50-50UL
About this Product
- SKU:
- GP-029-50
- Additional Names:
- Agrp; Agrt; Art; Agouti-related protein
- Application:
- IHC-Frozen
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Extra Details:
- Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen., Biosensis
- Host:
- Guinea Pig
- Immunogen:
- A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
- Isotype:
- Mixed
- Physical State:
- Lyophilized
- Purification:
- Neat Serum
- Reactivities:
- Human, Mouse, Rat, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
- Supplier:
- Biosensis
- Type:
- Antibody: Polyclonal Antibody
