Recombinant Mouse Asialoglyco protein receptor 1
Product Sizes
20 ug
OPCA00018-20UG
100 ug
OPCA00018-100UG
About this Product
- SKU:
- OPCA00018
- Additional Names:
- A;AS;Asg;ASGPR1;Asgr;Asgr-1;asialoglycoprotein receptor 1;hepatic lectin 1;HL-1.|asialoglycoprotein receptor 1
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- Asgr1
- Molecular Weight:
- 52.8 kDa
- Purity:
- >90%
- Reactivities:
- Mouse
- Sequence:
- QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php