Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric monoclonal antibody
Product Sizes
100 ul
£563.00
78-002-100UL
About this Product
- SKU:
- 78-002
- Additional Names:
- Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
- Application:
- Electron Microscopy, ELISA, Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, Western Blot
- CE/IVD:
- RUO
- translate.label.attr.clone:
- L21/32
- Clonality:
- Recombinant Monoclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- Our chicken Anti-GluA2/GluR2 glutamate receptor recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in WB, IHC, ICC, IP, ELISA, EM., Aves Labs
- Host:
- Chicken/Avian
- Immunogen:
- Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
- Isotype:
- IgY
- Molecular Weight:
- 90 kDa
- Physical State:
- Liquid
- Purification:
- Purified by affinity chromatography|This recombinant antibody is a chimeric antibody created by replacing the mouse heavy and light constant regions of clone L21/32 with chicken IgY heavy and light co
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Specificity:
- Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Type:
- Antibody: Recombinant Antibodies
