anti-IRF9 antibody
Product Sizes
50 ul
£429.00
ARG59246-50UL
About this Product
- SKU:
- ARG59246
- Additional Names:
- ISGF-3 gamma; Transcriptional regulator ISGF3 subunit gamma; ISGF3G; ISGF3; Interferon-stimulated gene factor 3 gamma; IRF-9; ISGF3 p48 subunit; p48; IFN-alpha-responsive transcription factor subunit; Interferon regulatory factor 9
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 - 1 mg/ml
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide around the N-terminal region of Human IRF9. (within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Fish, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG59246.html
