anti-IL28RA antibody
Product Sizes
50 ul
£429.00
ARG41102-50UL
About this Product
- SKU:
- ARG41102
- Additional Names:
- IFNLR; IFN-lambda-R1; IL-28RA; IL28RA; Interferon lambda receptor 1; LICR2; CRF2-12; IFN-lambda receptor 1; Cytokine receptor class-II member 12; Interleukin-28 receptor subunit alpha; Likely interleukin or cytokine receptor 2; IL-28R1; CRF2/12; Cytokine receptor family 2 member 12; IL-28R-alpha; IL-28 receptor subunit alpha
- Application:
- Western Blot
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 - 1 mg/ml
- Extra Details:
- The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide around the N-terminal region of Human IL28RA. (within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG41102.html
