anti-Kininogen 1 antibody
Product Sizes
50 ug
£408.00
ARG40932-50UG
About this Product
- SKU:
- ARG40932
- Additional Names:
- Williams-Fitzgerald-Flaujeac factor; Kallidin II; High molecular weight kininogen; KNG; Fitzgerald factor; Alpha-2-thiol proteinase inhibitor; BDK; BK; Kininogen-1; HMWK; Kallidin I; Ile-Ser-Bradykinin
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. Bradykinin also functions as an antimicrobial peptide with antibacterial and antifungal activity. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2014]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa. 227-259 of Mouse Kininogen 1. (ECRGNLFMDINNKIANFSQSCTLYSGDDLVEAL)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG40932.html




