anti-CD119 / IFN gamma R1 antibody
Product Sizes
50 ug
£408.00
ARG40369-50UG
About this Product
- SKU:
- ARG40369
- Additional Names:
- IMD27B; IMD27A; CD119; CD antigen CD119; CDw119; Interferon gamma receptor 1; IFNGR; IFN-gamma receptor 1; IFN-gamma-R1
- Application:
- Flow Cytometry, Western Blot
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. [provided by RefSeq, Jul 2008]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa. 108-147 of Human CD119 / IFN gamma R1. (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG40369.html




