Anti-Kv1.2 Potassium Channel Subunit Antibody
Product Sizes
100 ul
£468.00
75-314-100UL
About this Product
- SKU:
- 75-314
- Additional Names:
- Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)
- Application:
- ELISA, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- 10 mM Tris, 50 mM Sodium Chloride
- CE/IVD:
- RUO
- translate.label.attr.clone:
- L76/36
- Clonality:
- Monoclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- Our Anti-Kv1.2 potassium channel subunit mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L76/36. It is KO validated, detects human, mouse, and rat Kv1.2 potassium channel subunit, and is purified by Protein A chromatography. It is great for use in IHC, WB., AntibodiesInc
- Formulation:
- 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
- Host:
- Mouse
- Immunogen:
- Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (accession number P16389) produced recombinantly in E. Coli
- Isotype:
- IgG2a
- Molecular Weight:
- 80 kDa
- Physical State:
- Liquid
- Purification:
- Protein A Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Specificity:
- No cross-reactivity reported
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Type:
- Antibody: Monoclonal Antibody


