Anti-REEP1 Antibody FL594 Conjugate
Product Sizes
200 ul
£652.00
75-313-FL594-200UL
About this Product
- SKU:
- 75-313-FL594
- Additional Names:
- Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
- Application:
- Immunocytochemistry, Immunohistochemistry
- Buffer:
- PBS
- CE/IVD:
- RUO
- translate.label.attr.clone:
- N345/51
- Clonality:
- Monoclonal
- Conjugate:
- FL594
- Concentration:
- 0.5 mg/ml
- Extra Details:
- Our Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by Protein A chromatography. It is great for use in IHC, ICC., AntibodiesInc
- Formulation:
- PBS with 0.09% azide
- Host:
- Mouse
- Immunogen:
- Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
- Isotype:
- IgG2b
- Molecular Weight:
- 22 kda
- Physical State:
- Liquid
- Purification:
- Protein A Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Specificity:
- Does not cross-react with REEP2
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Type:
- Antibody: Monoclonal Antibody


