Anti-BAF53b Antibody FL594 Conjugate
Product Sizes
200 ul
£652.00
75-311-FL594-200UL
About this Product
- SKU:
- 75-311-FL594
- Additional Names:
- Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)
- Application:
- Immunocytochemistry, Immunohistochemistry
- Buffer:
- PBS
- CE/IVD:
- RUO
- translate.label.attr.clone:
- N332B/15
- Clonality:
- Monoclonal
- Conjugate:
- FL594
- Concentration:
- 0.5 mg/ml
- Extra Details:
- Our Anti-BAF53b mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by Protein A chromatography. It is great for use in IHC, ICC., AntibodiesInc
- Formulation:
- PBS with 0.09% azide
- Host:
- Mouse
- Immunogen:
- Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
- Isotype:
- IgG1
- Molecular Weight:
- 53 kDa
- Physical State:
- Liquid
- Purification:
- Protein A Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Blue Ice
- Specificity:
- Does not cross-react with BAF53a
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Type:
- Antibody: Monoclonal Antibody


