Anti-SUR1 and SUR2B Antibody (BSA and Azide free)
Product Sizes
100 ul
£652.00
75-298-CF-100UL
About this Product
- SKU:
- 75-298-CF
- Additional Names:
- ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
- Application:
- ELISA, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- PBS
- CE/IVD:
- RUO
- translate.label.attr.clone:
- N323A/31
- Clonality:
- Monoclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- Our carrier-free Anti-SUR1 and SUR2B mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N323A/31. It detects mouse and rat SUR1 and SUR2B, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB., AntibodiesInc
- Formulation:
- PBS
- Host:
- Mouse
- Immunogen:
- Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
- Isotype:
- IgG1
- Molecular Weight:
- 175 kDa (and smaller fragments likely due to proteolytic cleavage)
- Physical State:
- Liquid
- Purification:
- Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.|Purified by Protein
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Specificity:
- Cross-reacts with SUR1
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Type:
- Antibody: Monoclonal Antibody
