Anti-Ataxin-1, 11NQ Antibody FL650 Conjugate
Product Sizes
200 ul
£652.00
75-117-FL650-200UL
About this Product
- SKU:
- 75-117-FL650
- Additional Names:
- Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)
- Application:
- Immunocytochemistry, Immunohistochemistry
- Buffer:
- PBS
- CE/IVD:
- RUO
- translate.label.attr.clone:
- N76/8
- Clonality:
- Monoclonal
- Conjugate:
- FL650
- Concentration:
- 0.5 mg/ml
- Extra Details:
- Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC., AntibodiesInc
- Formulation:
- PBS with 0.09% azide
- Host:
- Mouse
- Immunogen:
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
- Isotype:
- IgG2b
- Molecular Weight:
- 85 kDa
- Physical State:
- Liquid
- Purification:
- Protein A Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Specificity:
- No cross-reactivity reported
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Type:
- Antibody: Monoclonal Antibody
