Anti-GluA2/GluR2 Glutamate Receptor Antibody (BSA and Azide free)
Product Sizes
100 ul
£652.00
75-002-CF-100UL
About this Product
- SKU:
- 75-002-CF
- Additional Names:
- Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
- Application:
- ELISA, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- PBS
- CE/IVD:
- RUO
- translate.label.attr.clone:
- L21/32
- Clonality:
- Monoclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- Our carrier-free Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by Protein A chromatography. It is great for use in EM, IHC, ICC, IP, WB., AntibodiesInc
- Formulation:
- PBS
- Host:
- Mouse
- Immunogen:
- Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
- Isotype:
- IgG1
- Molecular Weight:
- 90 kDa
- Physical State:
- Liquid
- Purification:
- Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.|Purified by Protein
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Specificity:
- Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Type:
- Antibody: Monoclonal Antibody
