Anti-gB [1G2]
Product Sizes
500 ug
AB04495-10-29-BT-500UG
About this Product
- SKU:
- AB04495-10-29-BT
- Additional Names:
- Envelope glycoprotein B; UL55; Ab-50
- Application:
- Block/Inhibit/Neutralise, Cell-based/Functional Assay, Crystallography, ELISA, FACS, Flow Cytometry, Immunoprecipitation, Surface Plasmon Resonance
- Buffer:
- PBS
- translate.label.attr.clone:
- 1G2
- Clonality:
- Recombinant Monoclonal
- Extra Details:
- This reformatted human antibody was made using the variable domain sequences of the original Human IgG3 format, for improved compatibility with existing reagents, assays and techniques.
- Formulation:
- PBS only.
- Host:
- Human
- Immunogen:
- The original antibody was isolated from EBV transformed human peripheral blood derived B cells derived from hCMV-infected donors.
- Purification:
- Purified
- Reactivities:
- Virus
- Shipping Conditions:
- Blue Ice
- Specificity:
- This antibody is specific for a surface epitope in antigenic domain 5 (AD-5), also termed Domain I (Dom I), of Human cytomegalovirus (hCMV) (strain Towne), also called Human herpesvirus 5 (HHV-5). Dom I resides between amino acid residues 133 to 343 of the gB of hCMV strain AD169 and has the following sequence: IVAHTFKVRVYQKVLTFRRSYAYIYTTYLLGSNTEYVAPPMWEIHHINKFAQCYSSYSRVIG GTVFVAYHRDSYENKTMQLIPDDY
- Storage Conditions:
- 2-8[o]C, -20[o]C aliquoted. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab04495-10.29-BT
