Anti-Envelopment polyprotein [RV-Gn3]
Product Sizes
1 mg
AB04482-23-0-BT-1MG
About this Product
- SKU:
- AB04482-23-0-BT
- Additional Names:
- GP; Gn; Glycoprotein N; M polyprotein
- Application:
- Block/Inhibit/Neutralise, Crystallography, ELISA
- Buffer:
- PBS
- translate.label.attr.clone:
- RV-Gn3
- Clonality:
- Recombinant Monoclonal
- Extra Details:
- This reformatted rabbit antibody was made using the variable domain sequences of the original Rabbit Fab format, for improved compatibility with existing reagents, assays and techniques.
- Formulation:
- PBS only.
- Host:
- Rabbit
- Immunogen:
- The original antibody was raised by immunizing a rabbit with the full-length RVFV Gn ectodomain.
- Isotype:
- IgG
- Purification:
- Purified
- Reactivities:
- Virus
- Shipping Conditions:
- Blue Ice
- Specificity:
- This antibody is specific for the sequence SQCPKIGGHGSKKCTGDAAFCSAYECTAQYAN of glycoprotein N from Rift valley fever virus.
- Storage Conditions:
- 2-8[o]C, -20[o]C aliquoted. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab04482-23.0-BT
