Anti-Caspase-3 [4F-6]
Product Sizes
1 mg
£2163.00
AB04219-23-0-BT-1MG
About this Product
- SKU:
- AB04219-23-0-BT
- Additional Names:
- CASP-3; CPP-32; SCA-1; EC:3.4.22.56; Apopain; Cysteine protease CPP32; Protein Yama
- Application:
- Block/Inhibit/Neutralise, ELISA, Western Blot
- Buffer:
- PBS
- translate.label.attr.clone:
- 4F-6
- Clonality:
- Recombinant Monoclonal
- Extra Details:
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.
- Formulation:
- PBS only.
- Host:
- Rabbit
- Immunogen:
- The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.
- Isotype:
- IgG
- Purification:
- Purified
- Reactivities:
- Human
- Shipping Conditions:
- Blue Ice
- Specificity:
- The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA.
- Storage Conditions:
- 2-8[o]C, -20[o]C aliquoted. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab04219-23.0-BT
