Anti-Caspase-3 [4F-6]
Product Sizes
100 ug
AB04219-1-1-100UG
About this Product
- SKU:
- AB04219-1-1
- Additional Names:
- CASP-3; CPP-32; SCA-1; EC:3.4.22.56; Apopain; Cysteine protease CPP32; Protein Yama
- Application:
- Block/Inhibit/Neutralise, ELISA, Western Blot
- Buffer:
- PBS with 0.02% Proclin 300.
- translate.label.attr.clone:
- 4F-6
- Clonality:
- Recombinant Monoclonal
- Formulation:
- PBS with 0.02% Proclin 300.
- Host:
- Mouse
- Immunogen:
- The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.
- Isotype:
- IgG1
- Purification:
- Purified
- Reactivities:
- Human
- Shipping Conditions:
- Blue Ice
- Specificity:
- The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA.
- Storage Conditions:
- 2-8[o]C Aliquot., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab04219-1.1
