Anti-OPG [AbAb01OPG]
Product Sizes
1 mg
AB04113-23-0-BT-1MG
About this Product
- SKU:
- AB04113-23-0-BT
- Additional Names:
- Osteoprotegerin; OCIF; PDB5; TR1; TNFRSF11B; Tumor necrosis factor receptor superfamily member 11b; TNF receptor superfamily member 11b; Osteoclastogenesis inhibitory factor
- Application:
- ELISA
- Buffer:
- PBS
- translate.label.attr.clone:
- AbAb01OPG
- Clonality:
- Recombinant Monoclonal
- Extra Details:
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.
- Formulation:
- PBS only.
- Host:
- Rabbit
- Immunogen:
- The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).
- Isotype:
- IgG
- Purification:
- Purified
- Reactivities:
- Human
- Shipping Conditions:
- Blue Ice
- Specificity:
- This antibody is specific for the N-terminal epitope of OPG.
- Storage Conditions:
- 2-8[o]C, -20[o]C aliquoted. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab04113-23.0-BT
