Anti-ApoA1 [D11-6]
Product Sizes
100 ug
AB03979-23-0-100UG
About this Product
- SKU:
- AB03979-23-0
- Additional Names:
- Apo-AI; ApoA-I; Apolipoprotein A-I; Apolipoprotein A1
- Application:
- ELISA
- Buffer:
- PBS with 0.02% Proclin 300.
- translate.label.attr.clone:
- D11-6
- Clonality:
- Recombinant Monoclonal
- Extra Details:
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
- Formulation:
- PBS with 0.02% Proclin 300.
- Host:
- Rabbit
- Immunogen:
- The original antibody was generated by immunizing BALB/c mice with human ApoA1.
- Isotype:
- IgG
- Purification:
- Purified
- Reactivities:
- Human
- Shipping Conditions:
- Blue Ice
- Specificity:
- The antibody is specific for ApoA1. The antibody recognizes the epitope exposed by the ApoA1 protein on an HDL subclass significantly positively correlated with CHD, and the recognition epitope is determined on a polypeptide sequence comprising 41 amino acids (LGEEMRDRRAHVDALRTHLAPYSDELRQRLAARLEALKEN). The antibody does not react with HSA and the recombinant protein SAA1. Apolipoprotein A1 (ApoA1)
- Storage Conditions:
- 2-8[o]C Aliquot., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab03979-23.0
