Anti-Bet v 1 [H3-1]

Product Sizes

1 mg

£4421.00

AB03208-30-11-BS-1MG

About this Product

SKU:: AB03208-30-11-BS
Additional Names:: BETVIA; BETVI; Major pollen allergen Bet v 1-A; Allergen Bet v 1-A; ALNGI; Major pollen allergen Aln g 1; Allergen Aln g I; CORAI; Major pollen allergen Cor a 1; Allergen Cor a I; MALDI; MALD1; Major allergen Mal d 1
Application:: ELISA
Buffer:: PBS
translate.label.attr.clone:: H3-1
Clonality:: Recombinant Monoclonal
Formulation:: PBS only.
Immunogen:: The original antibody was isolated from a phage-displayed combinatorial single-chain fragment (ScFv) library generated from the peripheral blood mononuclear cells of an immunized subject and screened for Bet v 1-reactive antibody fragments.
Purification:: Purified
Reactivities:: Plant
Shipping Conditions:: Blue Ice
Specificity:: This antibody reacts with native Bet v 1 and homologous allergens. This antibody can also bind Bet v 1-related allergens namely Aln g 1, Cor a 1, Mal d 1. This antibody specifically binds C-terminal F2 domain of Bet v 1 (amino acids 130-160) and the binding epitope comprises the amino acid sequence 'KAEQVKASKEMGETLLRAVESYLLAHSDAYN'. This antibody recognized not only folded Bet v 1 but also a synth
Storage Conditions:: 2-8[o]C, -20[o]C aliquoted. Avoid freeze/thaw cycles.
Supplier:: Absolute Antibody
Type:: Antibody: Recombinant Antibodies

Basket