Anti-Bet v 1 [H3-1]
Product Sizes
1 mg
£1962.00
AB03208-1-1-BT-1MG
About this Product
- SKU:
- AB03208-1-1-BT
- Additional Names:
- BETVIA; BETVI; Major pollen allergen Bet v 1-A; Allergen Bet v 1-A; ALNGI; Major pollen allergen Aln g 1; Allergen Aln g I; CORAI; Major pollen allergen Cor a 1; Allergen Cor a I; MALDI; MALD1; Major allergen Mal d 1
- Application:
- ELISA
- Buffer:
- PBS
- translate.label.attr.clone:
- H3-1
- Clonality:
- Recombinant Monoclonal
- Extra Details:
- This full-length chimeric mouse antibody was made using the variable domain sequences of the original Human scFv format for improved compatibility with existing reagents assays and techniques.
- Formulation:
- PBS only.
- Host:
- Mouse
- Immunogen:
- The original antibody was isolated from a phage-displayed combinatorial single-chain fragment (ScFv) library generated from the peripheral blood mononuclear cells of an immunized subject and screened for Bet v 1-reactive antibody fragments.
- Isotype:
- IgG1
- Purification:
- Purified
- Reactivities:
- Plant
- Shipping Conditions:
- Blue Ice
- Specificity:
- This antibody reacts with native Bet v 1 and homologous allergens. This antibody can also bind Bet v 1-related allergens namely Aln g 1, Cor a 1, Mal d 1. This antibody specifically binds C-terminal F2 domain of Bet v 1 (amino acids 130-160) and the binding epitope comprises the amino acid sequence 'KAEQVKASKEMGETLLRAVESYLLAHSDAYN'. This antibody recognized not only folded Bet v 1 but also a synth
- Storage Conditions:
- 2-8[o]C, -20[o]C aliquoted. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab03208-1.1-BT
