Anti-Strep-Tag II [C23.21]
Product Sizes
200 ug
AB02208-23-0-200UG
About this Product
- SKU:
- AB02208-23-0
- Additional Names:
- Streptavidin; 'WSHPQFEK'; strep-tag
- Application:
- ELISA, Western Blot
- Buffer:
- PBS with 0.02% Proclin 300.
- translate.label.attr.clone:
- C23.21
- Clonality:
- Recombinant Monoclonal
- Extra Details:
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.
- Formulation:
- PBS with 0.02% Proclin 300.
- Host:
- Rabbit
- Immunogen:
- The original antibody was generated by immunizing BALB/c mice with recombinant ectodomain of glycoprotein E2 of GB virus, containing a double Strep-Tag of amino acid sequence 'AGWSHPQFEKGGGSGGGSGGGSWSHPQFEK'.
- Isotype:
- IgG
- Purification:
- Purified
- Reactivities:
- Bacteria
- Shipping Conditions:
- Blue Ice
- Specificity:
- This antibody recognizes an antigen with amino acid sequence 'WSHPQFEK' present in the Strep Tag with a dissociation constant of 1.4x10^-10M. It recognizes another fusion protein namely VHH-E9 containing the strep-tag sequence of 'LESAWSHPQFEK' at the C terminus with a dissociation constant of 9.1x10^-10M.
- Storage Conditions:
- 2-8[o]C Aliquot., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab02208-23.0
