Anti-ZP2 [IE3]
Product Sizes
1 mg
AB00954-7-4-BT-1MG
About this Product
- SKU:
- AB00954-7-4-BT
- Additional Names:
- Zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; ZP-2; Zp2; Zp-2; Zona pellucida protein A
- Application:
- Block/Inhibit/Neutralise, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
- Buffer:
- PBS
- translate.label.attr.clone:
- IE3
- Clonality:
- Recombinant Monoclonal
- Formulation:
- PBS only.
- Host:
- Rat
- Immunogen:
- Osbourne-Mendel rats were immunised with solubilised zonae pellucidae from DBA/2 mice. Splenocytes were obtained from immunised rats and fused with the SP2/2 murine myeloma cell line to generate hybridomas.
- Isotype:
- IgG2a
- Purification:
- Purified
- Reactivities:
- Mouse
- Shipping Conditions:
- Blue Ice
- Specificity:
- IE3 reacts specifically with ZP2 (East & Dean, 1984), where the specific epitope (TIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFC) is at the N-terminus. ZP2 is a glycoprotein which forms the zona pellucida, an extracellular matrix surrounding mammalian oocytes. These glycoproteins act as receptors for sperm and this recognition serves as a critical step of fertilisation.
- Storage Conditions:
- 2-8[o]C, -20[o]C aliquoted. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab00954-7.4-BT
