Anti-ZP2 [IE3]
Product Sizes
200 ug
AB00954-23-0-200UG
About this Product
- SKU:
- AB00954-23-0
- Additional Names:
- Zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; ZP-2; Zp2; Zp-2; Zona pellucida protein A
- Application:
- Block/Inhibit/Neutralise, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
- Buffer:
- PBS with 0.02% Proclin 300.
- translate.label.attr.clone:
- IE3
- Clonality:
- Recombinant Monoclonal
- Extra Details:
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques.
- Formulation:
- PBS with 0.02% Proclin 300.
- Host:
- Rabbit
- Immunogen:
- Osbourne-Mendel rats were immunised with solubilised zonae pellucidae from DBA/2 mice. Splenocytes were obtained from immunised rats and fused with the SP2/2 murine myeloma cell line to generate hybridomas.
- Isotype:
- IgG
- Purification:
- Purified
- Reactivities:
- Mouse
- Shipping Conditions:
- Blue Ice
- Specificity:
- IE3 reacts specifically with ZP2 (East & Dean, 1984), where the specific epitope (TIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFC) is at the N-terminus. ZP2 is a glycoprotein which forms the zona pellucida, an extracellular matrix surrounding mammalian oocytes. These glycoproteins act as receptors for sperm and this recognition serves as a critical step of fertilisation.
- Storage Conditions:
- 2-8[o]C Aliquot., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Absolute Antibody
- Type:
- Antibody: Recombinant Antibodies
- Manufacturer's Data Sheet:Ab00954-23.0
