Anti-Wnt7a Polyclonal Antibody
Product Sizes
100 μg/vial
£785.00
39-2011-100UG
About this Product
- SKU:
- 39-2011
- Additional Names:
- Protein Wnt-7a; WNT7A
- Clonality:
- Polyclonal
- Extra Details:
- This gene is a member of the WNT gene family; which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes; including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract; and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas €“ Rothschild / Schinzel phocomelia syndromes.
- Format:
- Lyophilized
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK); identical to the related Mouse sequence.
- Isotype:
- Rabbit IgG
- Purification:
- Immunogen affinity purified.
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- At -20[o]C for one year. After reconstitution; at 4[o]C for one month. It can also be aliquotted and stored frozen at -20[o]C for a longer time. Avoid repeated freezing and thawing.
- Supplier:
- Abeomics
- Type:
- Antibodies:Polyclonal Antibody
- Manufacturer's Data Sheet:1.jpg
