Anti-FABP4 Polyclonal Antibody
Product Sizes
100 μg/vial
£785.00
39-2008-100UG
About this Product
- SKU:
- 39-2008
- Additional Names:
- Fatty acid-binding protein; adipocyte; Adipocyte lipid-binding protein; ALBP; Adipocyte-type fatty acid-binding protein; A-FABP; AFABP; Fatty acid-binding protein 4; FABP4
- Clonality:
- Polyclonal
- Extra Details:
- Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein; aP2 (FABP4) is expressed in adipocytes and macrophages; and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome; including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.
- Format:
- Lyophilized
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN); identical to the related Mouse and Rat sequences.
- Isotype:
- Rabbit IgG
- Purification:
- Immunogen affinity purified.
- Reactivities:
- Mouse
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- At -20[o]C for one year. After reconstitution; at 4[o]C for one month. It can also be aliquotted and stored frozen at -20[o]C for a longer time. Avoid repeated freezing and thawing.
- Supplier:
- Abeomics
- Type:
- Antibodies:Polyclonal Antibody
- Manufacturer's Data Sheet:1.jpg
