Monoclonal Antibody to MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(Clone : 2F6)
Product Sizes
100 µg
£716.00
36-1423-100UG
About this Product
- SKU:
- 36-1423
- Additional Names:
- MAP3K1||MAPKKK1||MEKK||MEKK1
- translate.label.attr.clone:
- 2F6
- Clonality:
- Monoclonal
- Extra Details:
- Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli; including growth factors. The MEK kinases (also designated MAP kinase kinase kinases; MKKKs; MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs); including ERK; JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1; Raf-B; Mos; MEK kinase-1; MEK kinase-2; MEK kinase-3; MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4; and also activates the central protein kinases of the NFkB pathway; CHUK and IKBKB. Additionally; MEK kinase-1 uses an E3 ligase through its PHD domain; a RING-finger-like structure; to target proteins for degradation through ubiquitination.
- Format:
- Purified
- Host:
- Mouse
- Immunogen:
- Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
- Isotype:
- Mouse IgG2a; kappa
- Purification:
- Affinity Chromatography
- Reactivities:
- Human
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store the antibody at 4[o]C; stable for 6 months. For long-term storage; store at -20[o]C. Avoid repeated freeze and thaw cycles.
- Supplier:
- Abeomics
- Type:
- Antibodies:Monoclonal Antibody
- Manufacturer's Data Sheet:1.jpg
