Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout

TLR2/HEK293 Stable Cell Line

Product Sizes
1 Vial
£2747.00
14-531ACL-1VIAL
About this Product
SKU:
14-531ACL
Extra Details:
TLR2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human Toll-like receptor 2 (TLR2; also designated as CD282). TLR2 mediates immune responses by recognition of lipid-containing pathogen-associated molecular patterns (PAMPs) such as lipoteichoic acid and di- and tri-acylated cysteine-containing lipoproteins. TLR2 forms heterodimers with TLR1 or TLR6 as the initial step in a signal transduction cascade which leads to significant innate immune responses as well as development of adaptive immunity. TLR2-TLR1 heterodimers recognize triacylated lipopeptides from Gram-negative bacteria and mycoplasma; while TLR2-TLR6 heterodimers recognize diacylated lipopeptides from Gram-positive bacteria and mycoplasma. Note that TLR2 in the TLR2/HEK293 stable cell line contains the N-terminal HA tag (Figure 2); which does not interfere with TLR2 activity as confirmed by functional assay (Figure 1). Sequence data: Human TLR2 (accession number NP_001305716) MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLN SIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSL EHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMD TFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFV DVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQI SGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSL TERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTL ILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHS VTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISR NAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDS PSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAW LQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPG KWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPI EKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Shipping Conditions:
Blue Ice
Storage Conditions:
Immediately upon receipt; store in liquid nitrogen.
Supplier:
Abeomics
Type:
Cells:Cell Lines