Recombinant Cynomolgus IgE Protein
Product Sizes
20 ug
£181.00
RPT0037-20UG
50 ug
£240.00
RPT0037-50UG
100 ug
£353.00
RPT0037-100UG
500 ug
£1002.00
RPT0037-500UG
1000 ug
£1574.00
RPT0037-1000UG
About this Product
- SKU:
- RPT0037
- Additional Names:
- Ig-like domain-containing protein ,EGM_20642,IgE
- Extra Details:
- IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation.
- Formulation:
- Recombinant Cynomolgus IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys208-Lys429) of Cynomolgus IgE (Accession # G8F4W7) fused with His ta
- Immunogen:
- Lys208-Lys429
- Molecular Weight:
- 35-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- KCADSNPRGVSAYLSRPSPFDLFISKSPTITCLVVDLAPSKETVNLTWSRASGKPVPHIPATEKKQQRNGTLTVTSILPVVTQDWIEGETYQCRVIHPHLPRALVRSMTKTSGPRAAPEVYVFATPEKLESRDKRTLACLIENFMPEDISVQWLHSDVQLPDTRHSVTQPRKTKGSGFFVFSRLEVTKAEWEQKDEFICRAVHEAASPSWIVQQAVSVNPGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0037
