Recombinant Mouse IgA Protein
Product Sizes
50 ug
£193.00
RPT0027-50UG
100 ug
£276.00
RPT0027-100UG
About this Product
- SKU:
- RPT0027
- Additional Names:
- IgA,Igha,Immunoglobulin heavy constant alpha
- Extra Details:
- Recombinant Recombinant Mouse IgA Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys99-Tyr344) of Mouse IgA fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Lys99-Tyr344
- Molecular Weight:
- 27.31 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KCSGPPPPCPPCPPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAKVTVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGICY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RPT0027
